PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004495851.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 428aa    MW: 48410 Da    PI: 6.6652
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004495851.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
   XP_004495851.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding44.82.9e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   XP_004495851.1  67 RGTFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466893.67E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-151461IPR001005SANT/Myb domain
CDDcd001672.06E-111761No hitNo description
PROSITE profilePS5129425.35762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2565116IPR009057Homeodomain-like
SMARTSM007177.3E-1366114IPR001005SANT/Myb domain
PfamPF002493.5E-1367111IPR001005SANT/Myb domain
CDDcd001671.07E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQDEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPVTHKPLS EVENLEDNVK SQEKVAQVSN ELNLLKSESS KSDAASCDHR TSTSLSPKAY  180
AQEMDGSGSY TKSESSNLMN SKDMFLDKFM NHQTDLMANF PLQMSFSNTE NDCLTNDSNS  240
SHWFNQTGKT FDMNSEFPFN SNSILTPTTT TSTTTMFLPN SFCCNDSSLA TIHSDNVSTP  300
CGSNYWEVNR SDNRSNNSST LNLQNNIFSS WGLADCSINS TKEAQIHDMI EHNHAEEEAK  360
WENNYLHNPI LMLASESLCN EIKPSMMQLV PHDTLGAILP HTKQQEQSQA SNIFSKDIQK  420
LRAAFGDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0528491e-114BT052849.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-P-4 unknown mRNA.
GenBankBT1474771e-114BT147477.1 Medicago truncatula clone JCVI-FLMt-12D24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004495851.10.0PREDICTED: protein ODORANT1-like
TrEMBLA0A0S3SQV40.0A0A0S3SQV4_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TYY30.0A0A0L9TYY3_PHAAN; Uncharacterized protein
STRINGGLYMA10G27940.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-93myb domain protein 55